Lineage for d1dosa_ (1dos A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 817252Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 817708Family c.1.10.2: Class II FBP aldolase [51591] (2 proteins)
    metal-dependent
  6. 817709Protein Fructose-bisphosphate aldolase (FBP aldolase) [51592] (2 species)
  7. 817710Species Escherichia coli [TaxId:562] [51593] (4 PDB entries)
  8. 817711Domain d1dosa_: 1dos A: [29175]

Details for d1dosa_

PDB Entry: 1dos (more details), 1.67 Å

PDB Description: structure of fructose-bisphosphate aldolase
PDB Compounds: (A:) aldolase class II

SCOP Domain Sequences for d1dosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dosa_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 562]}
skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykagnvvltpti
lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl

SCOP Domain Coordinates for d1dosa_:

Click to download the PDB-style file with coordinates for d1dosa_.
(The format of our PDB-style files is described here.)

Timeline for d1dosa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dosb_