Lineage for d1dosa_ (1dos A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835398Family c.1.10.2: Class II FBP aldolase [51591] (3 proteins)
    metal-dependent
    automatically mapped to Pfam PF01116
  6. 2835399Protein Fructose-bisphosphate aldolase (FBP aldolase) [51592] (3 species)
  7. 2835400Species Escherichia coli [TaxId:562] [51593] (4 PDB entries)
  8. 2835401Domain d1dosa_: 1dos A: [29175]
    complexed with nh4, zn

Details for d1dosa_

PDB Entry: 1dos (more details), 1.67 Å

PDB Description: structure of fructose-bisphosphate aldolase
PDB Compounds: (A:) aldolase class II

SCOPe Domain Sequences for d1dosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dosa_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Escherichia coli [TaxId: 562]}
skifdfvkpgvitgddvqkvfqvakennfalpavncvgtdsinavletaakvkapvivqf
snggasfiagkgvksdvpqgaailgaisgahhvhqmaehygvpvilhtdhcakkllpwid
glldagekhfaatgkplfsshmidlseeslqenieicskylermskigmtleielgctgg
eedgvdnshmdasalytqpedvdyaytelskisprftiaasfgnvhgvykagnvvltpti
lrdsqeyvskkhnlphnslnfvfhggsgstaqeikdsvsygvvkmnidtdtqwatwegvl
nyykaneaylqgqlgnpkgedqpnkkyydprvwlragqtsmiarlekafqelnaidvl

SCOPe Domain Coordinates for d1dosa_:

Click to download the PDB-style file with coordinates for d1dosa_.
(The format of our PDB-style files is described here.)

Timeline for d1dosa_: