Lineage for d1qfeb_ (1qfe B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1342159Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1342656Protein Type I 3-dehydroquinate dehydratase [51586] (3 species)
  7. 1342657Species Salmonella typhi [TaxId:90370] [51587] (3 PDB entries)
  8. 1342660Domain d1qfeb_: 1qfe B: [29168]
    complexed with dhs

Details for d1qfeb_

PDB Entry: 1qfe (more details), 2.1 Å

PDB Description: the structure of type i 3-dehydroquinate dehydratase from salmonella typhi
PDB Compounds: (B:) protein (3-dehydroquinate dehydratase)

SCOPe Domain Sequences for d1qfeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfeb_ c.1.10.1 (B:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]}
mktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqs
vltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftg
dadvkatvdyahahnvyvvmsnhdfhqtpsaeemvsrlrkmqalgadipkiavmpqskhd
vltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkqasapgqiavn
dlrsvlmilhna

SCOPe Domain Coordinates for d1qfeb_:

Click to download the PDB-style file with coordinates for d1qfeb_.
(The format of our PDB-style files is described here.)

Timeline for d1qfeb_: