SCOPe 2.05: Domain d1fq0a_: 1fq0 A:

Lineage for d1fq0a_ (1fq0 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein KDPG aldolase [51584] (3 species)

7. Species Escherichia coli [TaxId:562] [51585] (7 PDB entries)

8. Domain d1fq0a_: 1fq0 A: [29161]
   complexed with cit

Details for d1fq0a_

PDB Entry: 1fq0, 2.1 Å

PDB Description: kdpg aldolase from escherichia coli

PDB Compounds: (A:) kdpg aldolase

SCOPe Domain Sequences for d1fq0a_:

Sequence; same for both SEQRES and ATOM records:

>d1fq0a_ c.1.10.1 (A:) KDPG aldolase {Escherichia coli [TaxId: 562]}
mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlevtlrtecavdairai
akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
iggswlvpadaleagdydritklareavegakl

Timeline for d1fq0a_:

• d1fq0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fq0a_ appears in SCOPe 2.04
  
• d1fq0a_ appears in SCOPe 2.06
  
• d1fq0a_ appears in the current release, SCOPe 2.08