Lineage for d1eunb_ (1eun B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19200Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 19201Family c.1.10.1: Class I aldolase [51570] (6 proteins)
  6. Protein KDPG aldolase [51584] (1 species)
  7. Species Escherichia coli [TaxId:562] [51585] (4 PDB entries)
  8. Domain d1eunb_: 1eun B: [29159]

Details for d1eunb_

PDB Entry: 1eun (more details), 2 Å

PDB Description: structure of 2-keto-3-deoxy-6-phosphogluconate aldolase from escherichia coli

SCOP Domain Sequences for d1eunb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eunb_ c.1.10.1 (B:) KDPG aldolase {Escherichia coli}
mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlevtlrtecavdairai
akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
iggswlvpadaleagdydritklareavegakl

SCOP Domain Coordinates for d1eunb_ are not available.

Timeline for d1eunb_:

Domains from other chains:
(mouse over for more information)
d1euna_, d1eunc_