Lineage for d1euab_ (1eua B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2096923Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2097356Protein KDPG aldolase [51584] (3 species)
  7. 2097357Species Escherichia coli [TaxId:562] [51585] (7 PDB entries)
  8. 2097371Domain d1euab_: 1eua B: [29156]
    Schiff base intermediate
    complexed with act, pyr, so4

Details for d1euab_

PDB Entry: 1eua (more details), 1.95 Å

PDB Description: schiff base intermediate in kdpg aldolase from escherichia coli
PDB Compounds: (B:) kdpg aldolase

SCOPe Domain Sequences for d1euab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1euab_ c.1.10.1 (B:) KDPG aldolase {Escherichia coli [TaxId: 562]}
mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlevtlrtecavdairai
akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
iggswlvpadaleagdydritklareavegakl

SCOPe Domain Coordinates for d1euab_:

Click to download the PDB-style file with coordinates for d1euab_.
(The format of our PDB-style files is described here.)

Timeline for d1euab_: