Lineage for d1epxc_ (1epx C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1342159Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1342374Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species)
  7. 1342541Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51582] (4 PDB entries)
  8. 1342548Domain d1epxc_: 1epx C: [29152]

Details for d1epxc_

PDB Entry: 1epx (more details), 1.8 Å

PDB Description: crystal structure analysis of aldolase from l. mexicana
PDB Compounds: (C:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d1epxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epxc_ c.1.10.1 (C:) Fructose-1,6-bisphosphate aldolase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdd

SCOPe Domain Coordinates for d1epxc_:

Click to download the PDB-style file with coordinates for d1epxc_.
(The format of our PDB-style files is described here.)

Timeline for d1epxc_: