Lineage for d1epxa_ (1epx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834647Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51582] (1 PDB entry)
  8. 2834849Domain d1epxa_: 1epx A: [29150]

Details for d1epxa_

PDB Entry: 1epx (more details), 1.8 Å

PDB Description: crystal structure analysis of aldolase from l. mexicana
PDB Compounds: (A:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d1epxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epxa_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
msrvtvlqsqlpaynrlktpyeseliatvkklttpgkgllaadesigsctkrfqpiglsn
teehrrqyralmleaegfeqyisgvilhdetvgqkasngqtfpeyltargvvpgiktdmg
lcpllegaegeqmtegldgyvkrasayykkgcrfckwrnvykiqngtvsesavrfnaetl
aryailsqmsglvpivepevmidgkhdidtcqrvsehvwrevvaalqrhgviwegcllkp
nmvvpgaesgktaapeqvahytvmtlartmpamlpgvmflsgglsevqaseylnainnsp
lprpyflsfsyaralqssalkawggkesglaagrraflhrarmnsmaqlgkykrsdd

SCOPe Domain Coordinates for d1epxa_:

Click to download the PDB-style file with coordinates for d1epxa_.
(The format of our PDB-style files is described here.)

Timeline for d1epxa_: