Lineage for d1a5cb_ (1a5c B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1821887Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. 1821935Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51581] (1 PDB entry)
  8. 1821937Domain d1a5cb_: 1a5c B: [29149]

Details for d1a5cb_

PDB Entry: 1a5c (more details), 3 Å

PDB Description: fructose-1,6-bisphosphate aldolase from plasmodium falciparum
PDB Compounds: (B:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d1a5cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5cb_ c.1.10.1 (B:) Fructose-1,6-bisphosphate aldolase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
lpadvaeelattaqklvqagkgilaadestqtikkrfdniklentienrasyrdllfgtk
glgkfisgailfeetlfqkneagvpmvnllhneniipgikvdkglvnipctdeekstqgl
dglaerckeyykagarfakwrtvlvidtakgkptdlsihetawglaryasicqqnrlvpi
vepeiladgphsievcavvtqkvlscvfkalqengvllegallkpnmvtagyectakttt
qdvgfltvrtlrrtvppalpgvvflsggqseeeasvnlnsinalgphpwaltfsygralq
asvlntwqgkkenvakarevllqraeanslatygkykggagg

SCOPe Domain Coordinates for d1a5cb_:

Click to download the PDB-style file with coordinates for d1a5cb_.
(The format of our PDB-style files is described here.)

Timeline for d1a5cb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a5ca_