Lineage for d6aldb_ (6ald B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.10: Aldolase [51569] (4 families) 
Family c.1.10.1: Class I aldolase [51570] (6 proteins) 
Protein Fructose-1,6-bisphosphate aldolase [51576] (7 species) 
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51580] (6 PDB entries) 
Domain d6aldb_: 6ald B: [29145]
Details for d6aldb_
PDB Entry: 6ald (more details), 2.3 Å
PDB Description: rabbit muscle aldolase a/fructose-1,6-bisphosphate complex
SCOP Domain Sequences for d6aldb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6aldb_ c.1.10.1 (B:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus)}
hshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrql
lltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtnge
tttqgldglsercaqykkdgadfaawrcvlkigehtpsalaimenanvlaryasicqqng
ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghactq
kysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfsy
gralqasalkawggkkenlkaaqeeyvkralanslacqgkytp
SCOP Domain Coordinates for d6aldb_:
Click to download the PDB-style file with coordinates for d6aldb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6aldb_:
- d6aldb_ appears in SCOP 1.57
- d6aldb_ appears in the current release, SCOPe 2.08
View in 3D
