Lineage for d1ex5d_ (1ex5 D:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572455Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 572456Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 572581Protein Fructose-1,6-bisphosphate aldolase [51576] (8 species)
  7. 572618Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (7 PDB entries)
  8. 572630Domain d1ex5d_: 1ex5 D: [29143]
    mutant

Details for d1ex5d_

PDB Entry: 1ex5 (more details), 2.2 Å

PDB Description: fructose 1,6-bisphosphate aldolase from rabbit muscle

SCOP Domain Sequences for d1ex5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ex5d_ c.1.10.1 (D:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme}
phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivapeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfisn
hay

SCOP Domain Coordinates for d1ex5d_:

Click to download the PDB-style file with coordinates for d1ex5d_.
(The format of our PDB-style files is described here.)

Timeline for d1ex5d_: