Lineage for d1ewda_ (1ewd A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19200Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 19201Family c.1.10.1: Class I aldolase [51570] (6 proteins)
  6. 19206Protein Fructose-1,6-bisphosphate aldolase [51576] (7 species)
  7. 19238Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51580] (6 PDB entries)
  8. 19247Domain d1ewda_: 1ewd A: [29132]

Details for d1ewda_

PDB Entry: 1ewd (more details), 2.46 Å

PDB Description: fructose 1,6-bisphosphate aldolase from rabbit muscle

SCOP Domain Sequences for d1ewda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewda_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus)}
phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgimvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytssgqagaaaseslfisn
hay

SCOP Domain Coordinates for d1ewda_:

Click to download the PDB-style file with coordinates for d1ewda_.
(The format of our PDB-style files is described here.)

Timeline for d1ewda_: