Lineage for d1adoc_ (1ado C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 684106Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species)
  7. 684175Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (13 PDB entries)
  8. 684186Domain d1adoc_: 1ado C: [29126]

Details for d1adoc_

PDB Entry: 1ado (more details), 1.9 Å

PDB Description: fructose 1,6-bisphosphate aldolase from rabbit muscle
PDB Compounds: (C:) aldolase

SCOP Domain Sequences for d1adoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adoc_ c.1.10.1 (C:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]}
phshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq
llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng
etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn
givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact
qkysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfs
ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytssgqagaaaseslfisn
hay

SCOP Domain Coordinates for d1adoc_:

Click to download the PDB-style file with coordinates for d1adoc_.
(The format of our PDB-style files is described here.)

Timeline for d1adoc_: