Lineage for d1fbad_ (1fba D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19200Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 19201Family c.1.10.1: Class I aldolase [51570] (6 proteins)
  6. 19206Protein Fructose-1,6-bisphosphate aldolase [51576] (7 species)
  7. 19207Species Drosophila melanogaster, strain sevelen (wild type, pupea) [51579] (1 PDB entry)
  8. 19211Domain d1fbad_: 1fba D: [29123]

Details for d1fbad_

PDB Entry: 1fba (more details), 1.9 Å

PDB Description: the crystal structure of fructose-1,6-bisphosphate aldolase from drosophila melanogaster at 2.5 angstroms resolution

SCOP Domain Sequences for d1fbad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbad_ c.1.10.1 (D:) Fructose-1,6-bisphosphate aldolase {Drosophila melanogaster, strain sevelen (wild type, pupea)}
ttyfnypskelqdelreiaqkivapgkgilaadesgptmgkrlqdigventednrrayrq
llfstdpklaenisgvilfhetlyqkaddgtpfaeilkkkgiilgikvdkgvvplfgsed
evttqglddlaarcaqykkdgcdfakwrcvlkigkntpsyqsilenanvlaryasicqsq
rivpivepevlpdgdhdldraqkvtetvlaavykalsdhhvylegtllkpnmvtagqsak
kntpeeialatvqalrrtvpaavtgvtflsggqseeeatvnlsainnvplirpwaltfsy
gralqasvlrawagkkeniaagqnellkrakangdaaqgkyvagsagagsgslfvanhay

SCOP Domain Coordinates for d1fbad_:

Click to download the PDB-style file with coordinates for d1fbad_.
(The format of our PDB-style files is described here.)

Timeline for d1fbad_: