SCOP 1.73: Domain d1fbac_: 1fba C:

Lineage for d1fbac_ (1fba C:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (8 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species)

7. Species Drosophila melanogaster [TaxId:7227] [51579] (1 PDB entry)

8. Domain d1fbac_: 1fba C: [29122]

Details for d1fbac_

PDB Entry: 1fba, 1.9 Å

PDB Description: the crystal structure of fructose-1,6-bisphosphate aldolase from drosophila melanogaster at 2.5 angstroms resolution

PDB Compounds: (C:) fructose 1,6-bisphosphate aldolase

SCOP Domain Sequences for d1fbac_:

Sequence; same for both SEQRES and ATOM records:

>d1fbac_ c.1.10.1 (C:) Fructose-1,6-bisphosphate aldolase {Drosophila melanogaster [TaxId: 7227]}
ttyfnypskelqdelreiaqkivapgkgilaadesgptmgkrlqdigventednrrayrq
llfstdpklaenisgvilfhetlyqkaddgtpfaeilkkkgiilgikvdkgvvplfgsed
evttqglddlaarcaqykkdgcdfakwrcvlkigkntpsyqsilenanvlaryasicqsq
rivpivepevlpdgdhdldraqkvtetvlaavykalsdhhvylegtllkpnmvtagqsak
kntpeeialatvqalrrtvpaavtgvtflsggqseeeatvnlsainnvplirpwaltfsy
gralqasvlrawagkkeniaagqnellkrakangdaaqgkyvagsagagsgslfvanhay

Timeline for d1fbac_:

• d1fbac_ first appeared (with stable ids) in SCOP 1.55
  
• d1fbac_ appears in SCOP 1.71
  
• d1fbac_ appears in SCOP 1.75
  
• d1fbac_ appears in the current release, SCOPe 2.08