Lineage for d3bz2x_ (3bz2 X:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2255005Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 2255006Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 2255010Protein automated matches [267680] (2 species)
    not a true protein
  7. 2255011Species Thermosynechococcus elongatus [TaxId:197221] [311275] (7 PDB entries)
  8. 2255017Domain d3bz2x_: 3bz2 X: [291183]
    Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2t_, d3bz2u_, d3bz2v_, d3bz2z_
    automated match to d4il6x_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2x_

PDB Entry: 3bz2 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer
PDB Compounds: (X:) Photosystem II PsbX protein

SCOPe Domain Sequences for d3bz2x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz2x_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
titpslkgffigllsgavvlgltfavliaisqidkvq

SCOPe Domain Coordinates for d3bz2x_:

Click to download the PDB-style file with coordinates for d3bz2x_.
(The format of our PDB-style files is described here.)

Timeline for d3bz2x_: