SCOPe 2.08: Domain d3bz2x_: 3bz2 X:

Lineage for d3bz2x_ (3bz2 X:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family)
   Pfam PF06596

5. Family f.23.40.1: PsbX-like [267615] (2 proteins)

6. Protein automated matches [267680] (2 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [311275] (12 PDB entries)

8. Domain d3bz2x_: 3bz2 X: [291183]
   Other proteins in same PDB: d3bz2a_, d3bz2b_, d3bz2c_, d3bz2d_, d3bz2e_, d3bz2f_, d3bz2h_, d3bz2i_, d3bz2j_, d3bz2k_, d3bz2l_, d3bz2m_, d3bz2o_, d3bz2t_, d3bz2u_, d3bz2v_, d3bz2z_
   automated match to d4il6x_
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz2x_

PDB Entry: 3bz2, 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 2 of 2). This file contains second monomer of PSII dimer

PDB Compounds: (X:) Photosystem II PsbX protein

SCOPe Domain Sequences for d3bz2x_:

Sequence; same for both SEQRES and ATOM records:

>d3bz2x_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
titpslkgffigllsgavvlgltfavliaisqidkvq

Timeline for d3bz2x_:

• d3bz2x_ first appeared in SCOPe 2.06
  
• d3bz2x_ appears in SCOPe 2.07