Lineage for d1dhpa_ (1dhp A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19200Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 19201Family c.1.10.1: Class I aldolase [51570] (6 proteins)
  6. 19202Protein Dihydrodipicolinate synthase [51574] (1 species)
  7. 19203Species Escherichia coli [TaxId:562] [51575] (1 PDB entry)
  8. 19204Domain d1dhpa_: 1dhp A: [29097]

Details for d1dhpa_

PDB Entry: 1dhp (more details), 2.5 Å

PDB Description: dihydrodipicolinate synthase

SCOP Domain Sequences for d1dhpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dhpa_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Escherichia coli}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigikeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

SCOP Domain Coordinates for d1dhpa_:

Click to download the PDB-style file with coordinates for d1dhpa_.
(The format of our PDB-style files is described here.)

Timeline for d1dhpa_: