Lineage for d1f5zc_ (1f5z C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683918Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 683919Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 684276Protein N-acetylneuraminate lyase [51571] (2 species)
  7. 684294Species Haemophilus influenzae [TaxId:727] [51573] (6 PDB entries)
  8. 684303Domain d1f5zc_: 1f5z C: [29087]

Details for d1f5zc_

PDB Entry: 1f5z (more details), 1.88 Å

PDB Description: crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form i
PDB Compounds: (C:) n-acetylneuraminate lyase

SCOP Domain Sequences for d1f5zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5zc_ c.1.10.1 (C:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]}
mrdlkgifsallvsfnedgtinekglrqiirhnidkmkvdglyvggstgenfmlsteekk
eifriakdeakdqialiaqvgsvnlkeavelgkyatelgydclsavtpfyykfsfpeikh
yydtiiaetgsnmivysipfltgvnmgieqfgelyknpkvlgvkftagdfyllerlkkay
pnhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltkagklkealeiqhvtnd
liegilanglyltikellklegvdagycrepmtskataeqvakakdlkakfls

SCOP Domain Coordinates for d1f5zc_:

Click to download the PDB-style file with coordinates for d1f5zc_.
(The format of our PDB-style files is described here.)

Timeline for d1f5zc_: