Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein N-acetylneuraminate lyase [51571] (2 species) |
Species Haemophilus influenzae [TaxId:727] [51573] (6 PDB entries) |
Domain d1f6ka_: 1f6k A: [29081] complexed with gol, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1f6k (more details), 1.6 Å
SCOPe Domain Sequences for d1f6ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f6ka_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} mrdlkgifsallvsfnedgtinekglrqiirhnidkmkvdglyvggstgenfmlsteekk eifriakdeakdqialiaqvgsvnlkeavelgkyatelgydclsavtpfyykfsfpeikh yydtiiaetgsnmivysipfltgvnmgieqfgelyknpkvlgvkftagdfyllerlkkay pnhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltkagklkealeiqhvtnd liegilanglyltikellklegvdagycrepmtskataeqvakakdlkakfls
Timeline for d1f6ka_: