Lineage for d3a68n_ (3a68 N:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2705060Species Soybean (Glycine max) [TaxId:3847] [255741] (4 PDB entries)
  8. 2705074Domain d3a68n_: 3a68 N: [290782]
    automated match to d3a68h_
    complexed with acy, ca

Details for d3a68n_

PDB Entry: 3a68 (more details), 1.8 Å

PDB Description: Crystal structure of plant ferritin reveals a novel metal binding site that functions as a transit site for metal transfer in ferritin
PDB Compounds: (N:) Ferritin-4, chloroplastic

SCOPe Domain Sequences for d3a68n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a68n_ a.25.1.0 (N:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
ifepfeevkkeldlvptvpqaslarqkyvdesesavneqinveynvsyvyhamfayfdrd
nvalrglakffkesseeerehaeklmeyqnkrggkvklqsivmplsdfdhadkgdalham
elalslekltnekllnlhsvatkngdvqladfveteylgeqveaikriseyvaqlrrvgk
ghgvwhfdqmllhe

SCOPe Domain Coordinates for d3a68n_:

Click to download the PDB-style file with coordinates for d3a68n_.
(The format of our PDB-style files is described here.)

Timeline for d3a68n_: