Lineage for d1fdyd_ (1fdy D:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19200Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 19201Family c.1.10.1: Class I aldolase [51570] (6 protein domains)
  6. 19284Protein N-acetylneuraminate lyase [51571] (2 species)
  7. 19285Species Escherichia coli [TaxId:562] [51572] (3 PDB entries)
  8. 19293Domain d1fdyd_: 1fdy D: [29074]

Details for d1fdyd_

PDB Entry: 1fdy (more details), 2.45 Å

PDB Description: n-acetylneuraminate lyase in complex with hydroxypyruvate

SCOP Domain Sequences for d1fdyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdyd_ c.1.10.1 (D:) N-acetylneuraminate lyase {Escherichia coli}
nlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereqvl
eivaeegkgkikliahvgcvttaesqqlaasakrygfdavsavtpfyypfsfeehcdhyr
aiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirrehpd
lvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnkvi
dlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmq

SCOP Domain Coordinates for d1fdyd_:

Click to download the PDB-style file with coordinates for d1fdyd_.
(The format of our PDB-style files is described here.)

Timeline for d1fdyd_: