Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein N-acetylneuraminate lyase [51571] (2 species) |
Species Escherichia coli [TaxId:562] [51572] (4 PDB entries) |
Domain d1fdyc_: 1fdy C: [29073] complexed with 3py |
PDB Entry: 1fdy (more details), 2.45 Å
SCOPe Domain Sequences for d1fdyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdyc_ c.1.10.1 (C:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} nlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereqvl eivaeegkgkikliahvgcvttaesqqlaasakrygfdavsavtpfyypfsfeehcdhyr aiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirrehpd lvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnkvi dlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmq
Timeline for d1fdyc_: