Lineage for d1nal2_ (1nal 2:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.10: Aldolase [51569] (4 families) 
Family c.1.10.1: Class I aldolase [51570] (6 proteins) Protein N-acetylneuraminate lyase [51571] (2 species) 
Species Escherichia coli [TaxId:562] [51572] (3 PDB entries) 
Domain d1nal2_: 1nal 2: [29068]
Details for d1nal2_
PDB Entry: 1nal (more details), 2.2 Å
PDB Description: the three-dimensional structure of n-acetylneuraminate lyase from escherichia coli
SCOP Domain Sequences for d1nal2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nal2_ c.1.10.1 (2:) N-acetylneuraminate lyase {Escherichia coli}
nlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereqvl
eivaeegkgkikliahvgcvttaesqqlaasakrygfdavsavtpfyypfsfeehcdhyr
aiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirrehpd
lvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnkvi
dlliktgvfrglktvlhymdvvsvplcrkpfgpvdekyqpelkalaqqlmq
SCOP Domain Coordinates for d1nal2_:
Click to download the PDB-style file with coordinates for d1nal2_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nal2_:
- d1nal2_ appears in SCOP 1.57
- d1nal2_ appears in the current release, SCOPe 2.08
View in 3D
