SCOP 1.73: Domain d1bf6b_: 1bf6 B:

Lineage for d1bf6b_ (1bf6 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (2 proteins)

6. Protein Phosphotriesterase homology protein [51567] (1 species)

7. Species Escherichia coli [TaxId:562] [51568] (1 PDB entry)

8. Domain d1bf6b_: 1bf6 B: [29066]
   complexed with gol, mpd, so4, zn

Details for d1bf6b_

PDB Entry: 1bf6, 1.7 Å

PDB Description: phosphotriesterase homology protein from escherichia coli

PDB Compounds: (B:) phosphotriesterase homology protein

SCOP Domain Sequences for d1bf6b_:

Sequence; same for both SEQRES and ATOM records:

>d1bf6b_ c.1.9.3 (B:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]}
sfdptgytlahehlhidlsgfknnvdcrldqyaficqemndlmtrgvrnviemtnrymgr
naqfmldvmretginvvactgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkag
iiaeigtsegkitpleekvfiaaalahnqtgrpisthtsfstmgleqlallqahgvdlsr
vtvghcdlkdnldnilkmidlgayvqfdtigknsyypdekriamlhalrdrgllnrvmls
mditrrshlkanggygydyllttfipqlrqsgfsqadvdvmlrenpsqffq

Timeline for d1bf6b_:

• d1bf6b_ first appeared (with stable ids) in SCOP 1.55
  
• d1bf6b_ appears in SCOP 1.71
  
• d1bf6b_ appears in SCOP 1.75
  
• d1bf6b_ appears in the current release, SCOPe 2.08