Lineage for d1bf6a_ (1bf6 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571126Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1571238Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. 1571314Protein Phosphotriesterase homology protein [51567] (1 species)
  7. 1571315Species Escherichia coli [TaxId:562] [51568] (1 PDB entry)
  8. 1571316Domain d1bf6a_: 1bf6 A: [29065]
    complexed with gol, mpd, so4, zn

Details for d1bf6a_

PDB Entry: 1bf6 (more details), 1.7 Å

PDB Description: phosphotriesterase homology protein from escherichia coli
PDB Compounds: (A:) phosphotriesterase homology protein

SCOPe Domain Sequences for d1bf6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]}
sfdptgytlahehlhidlsgfknnvdcrldqyaficqemndlmtrgvrnviemtnrymgr
naqfmldvmretginvvactgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkag
iiaeigtsegkitpleekvfiaaalahnqtgrpisthtsfstmgleqlallqahgvdlsr
vtvghcdlkdnldnilkmidlgayvqfdtigknsyypdekriamlhalrdrgllnrvmls
mditrrshlkanggygydyllttfipqlrqsgfsqadvdvmlrenpsqffq

SCOPe Domain Coordinates for d1bf6a_:

Click to download the PDB-style file with coordinates for d1bf6a_.
(The format of our PDB-style files is described here.)

Timeline for d1bf6a_: