Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins) automatically mapped to Pfam PF02126 |
Protein Phosphotriesterase homology protein [51567] (1 species) |
Species Escherichia coli [TaxId:562] [51568] (1 PDB entry) |
Domain d1bf6a_: 1bf6 A: [29065] complexed with gol, mpd, so4, zn |
PDB Entry: 1bf6 (more details), 1.7 Å
SCOPe Domain Sequences for d1bf6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bf6a_ c.1.9.3 (A:) Phosphotriesterase homology protein {Escherichia coli [TaxId: 562]} sfdptgytlahehlhidlsgfknnvdcrldqyaficqemndlmtrgvrnviemtnrymgr naqfmldvmretginvvactgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkag iiaeigtsegkitpleekvfiaaalahnqtgrpisthtsfstmgleqlallqahgvdlsr vtvghcdlkdnldnilkmidlgayvqfdtigknsyypdekriamlhalrdrgllnrvmls mditrrshlkanggygydyllttfipqlrqsgfsqadvdvmlrenpsqffq
Timeline for d1bf6a_: