Lineage for d1pta__ (1pta -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (4 families) 
Family c.1.9.3: Phosphotriesterase-like [51564] (2 proteins) Protein Phosphotriesterase [51565] (1 species) Species Pseudomonas diminuta [TaxId:293] [51566] (9 PDB entries) 
Domain d1pta__: 1pta - [29064]
Details for d1pta__
PDB Entry: 1pta (more details), 2.1 Å
PDB Description: three-dimensional structure of phosphotriesterase: an enzyme capable of detoxifying organophosphate nerve agents
SCOP Domain Sequences for d1pta__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pta__ c.1.9.3 (-) Phosphotriesterase {Pseudomonas diminuta}
rintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraagv
rtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflreiq
ygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaai
feseglspsrvcighsddtddlsyltalaargyligldhiphsaiallgirswqtralli
kalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvipflrekgvpqe
tlagitvtnparflsptl
SCOP Domain Coordinates for d1pta__:
Click to download the PDB-style file with coordinates for d1pta__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pta__:
- d1pta__ first appeared (with stable ids) in SCOP 1.55
- d1pta__ appears in SCOP 1.59
- d1pta__ appears in the current release, SCOPe 2.08, called d1ptaa_
View in 3D