Lineage for d1dpma_ (1dpm A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (3 families) 
Family c.1.9.3: Phosphotriesterase-like [51564] (2 proteins) 
Protein Phosphotriesterase [51565] (1 species) Species Pseudomonas diminuta [TaxId:293] [51566] (5 PDB entries) 
Domain d1dpma_: 1dpm A: [29062]
Details for d1dpma_
PDB Entry: 1dpm (more details), 2.1 Å
PDB Description: three-dimensional structure of the zinc-containing phosphotriesterase with bound substrate analog diethyl 4-methylbenzylphosphonate
SCOP Domain Sequences for d1dpma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dpma_ c.1.9.3 (A:) Phosphotriesterase {Pseudomonas diminuta}
arintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgi
rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpqetlagitvtnparflsptlr
SCOP Domain Coordinates for d1dpma_:
Click to download the PDB-style file with coordinates for d1dpma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dpma_:
- d1dpma_ appears in SCOP 1.57
- d1dpma_ appears in the current release, SCOPe 2.08
View in 3D
