SCOPe 2.01: Domain d1pscb_: 1psc B:

Lineage for d1pscb_ (1psc B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)

6. Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (3 species)

7. Species Pseudomonas diminuta [TaxId:293] [51566] (17 PDB entries)
   Uniprot P0A434 30-365

8. Domain d1pscb_: 1psc B: [29059]
   complexed with cd, ebp, fmt

Details for d1pscb_

PDB Entry: 1psc, 2 Å

PDB Description: phosphotriesterase from pseudomonas diminuta

PDB Compounds: (B:) phosphotriesterase

SCOPe Domain Sequences for d1pscb_:

Sequence; same for both SEQRES and ATOM records:

>d1pscb_ c.1.9.3 (B:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgi
rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpqetlagitvtnparflsptlra

Timeline for d1pscb_:

• d1pscb_ first appeared (with stable ids) in SCOP 1.55
  
• d1pscb_ appears in SCOP 1.75
  
• d1pscb_ appears in SCOPe 2.02
  
• d1pscb_ appears in the current release, SCOPe 2.08