Lineage for d2ubpc2 (2ubp C:132-434,C:484-570)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475145Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 475176Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 475177Protein alpha-subunit of urease, catalytic domain [51561] (3 species)
  7. 475178Species Bacillus pasteurii [TaxId:1474] [51563] (6 PDB entries)
  8. 475182Domain d2ubpc2: 2ubp C:132-434,C:484-570 [29055]
    Other proteins in same PDB: d2ubpa_, d2ubpb_, d2ubpc1

Details for d2ubpc2

PDB Entry: 2ubp (more details), 2 Å

PDB Description: structure of native urease from bacillus pasteurii

SCOP Domain Sequences for d2ubpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii}
ggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwniekmlksteglp
invgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvadeadvqvaihsd
tlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpsstnptrpftvnt
idehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismmstdalamgrag
emvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgiahevgsieegk
fadXgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidi
npetyevkvdgevltcepvkelpmaqryflf

SCOP Domain Coordinates for d2ubpc2:

Click to download the PDB-style file with coordinates for d2ubpc2.
(The format of our PDB-style files is described here.)

Timeline for d2ubpc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ubpc1