Lineage for d1ubpc2 (1ubp C:132-434,C:484-570)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833433Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 2833434Protein alpha-subunit of urease, catalytic domain [51561] (4 species)
  7. 2833435Species Bacillus pasteurii [TaxId:1474] [51563] (9 PDB entries)
  8. 2833443Domain d1ubpc2: 1ubp C:132-434,C:484-570 [29054]
    Other proteins in same PDB: d1ubpa_, d1ubpb_, d1ubpc1
    complexed with bme, ni

Details for d1ubpc2

PDB Entry: 1ubp (more details), 1.65 Å

PDB Description: crystal structure of urease from bacillus pasteurii inhibited with beta-mercaptoethanol at 1.65 angstroms resolution
PDB Compounds: (C:) urease

SCOPe Domain Sequences for d1ubpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii [TaxId: 1474]}
ggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwniekmlksteglp
invgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvadeadvqvaihsd
tlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpsstnptrpftvnt
idehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismmstdalamgrag
emvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgiahevgsieegk
fadXgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidi
npetyevkvdgevltcepvkelpmaqryflf

SCOPe Domain Coordinates for d1ubpc2:

Click to download the PDB-style file with coordinates for d1ubpc2.
(The format of our PDB-style files is described here.)

Timeline for d1ubpc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ubpc1