Lineage for d4ubpc2 (4ubp C:132-434,C:484-570)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19134Superfamily c.1.9: Metallo-dependent hydrolases [51556] (3 families) (S)
  5. 19152Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 19153Protein alpha-subunit of urease, catalytic domain [51561] (2 species)
  7. 19154Species Bacillus pasteurii [TaxId:1474] [51563] (4 PDB entries)
  8. 19155Domain d4ubpc2: 4ubp C:132-434,C:484-570 [29053]
    Other proteins in same PDB: d4ubpa_, d4ubpb_, d4ubpc1

Details for d4ubpc2

PDB Entry: 4ubp (more details), 1.55 Å

PDB Description: structure of bacillus pasteurii urease inhibited with acetohydroxamic acid at 1.55 a resolution

SCOP Domain Sequences for d4ubpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ubpc2 c.1.9.2 (C:132-434,C:484-570) alpha-subunit of urease, catalytic domain {Bacillus pasteurii}
ggidthvhfinpdqvdvalangittlfgggtgpaegskattvtpgpwniekmlksteglp
invgilgkghgssiapimeqidagaaglkihedwgatpasidrsltvadeadvqvaihsd
tlneagfledtlraingrvihsfhvegaggghapdimamaghpnvlpsstnptrpftvnt
idehldmlmvchhlkqnipedvafadsrirpetiaaedilhdlgiismmstdalamgrag
emvlrtwqtadkmkkqrgplaeekngsdnfrlkryvskytinpaiaqgiahevgsieegk
fadXgdlihdtnitfmskssiqqgvpaklglkrrigtvkncrnigkkdmkwndvttdidi
npetyevkvdgevltcepvkelpmaqryflf

SCOP Domain Coordinates for d4ubpc2:

Click to download the PDB-style file with coordinates for d4ubpc2.
(The format of our PDB-style files is described here.)

Timeline for d4ubpc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ubpc1