Lineage for d1ef2a2 (1ef2 A:1130-1422,A:1476-1567)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65203Superfamily c.1.9: Metallo-dependent hydrolases [51556] (4 families) (S)
  5. 65221Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 65222Protein alpha-subunit of urease, catalytic domain [51561] (2 species)
  7. 65229Species Klebsiella aerogenes [TaxId:28451] [51562] (25 PDB entries)
  8. 65251Domain d1ef2a2: 1ef2 A:1130-1422,A:1476-1567 [29051]
    Other proteins in same PDB: d1ef2a1, d1ef2b_, d1ef2c_

Details for d1ef2a2

PDB Entry: 1ef2 (more details), 2.5 Å

PDB Description: crystal structure of manganese-substituted klebsiella aerogenes urease
PDB Compounds: (A:)

SCOP Domain Sequences for d1ef2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef2a2 c.1.9.2 (A:1130-1422,A:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes}
gidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrmlqaadslpv
nigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdiqvalhsdt
lnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnptlpytlnti
dehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssdsqamgrvge
vilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgXmfgalg
sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
evrvdgelitsepadvlpmaqryflf

SCOP Domain Coordinates for d1ef2a2:

Click to download the PDB-style file with coordinates for d1ef2a2.
(The format of our PDB-style files is described here.)

Timeline for d1ef2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ef2a1