Lineage for d1ejtc2 (1ejt C:1130-1422,C:1476-1567)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 475145Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 475176Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 475177Protein alpha-subunit of urease, catalytic domain [51561] (3 species)
  7. 475188Species Klebsiella aerogenes [TaxId:28451] [51562] (27 PDB entries)
  8. 475195Domain d1ejtc2: 1ejt C:1130-1422,C:1476-1567 [29043]
    Other proteins in same PDB: d1ejta_, d1ejtb_, d1ejtc1

Details for d1ejtc2

PDB Entry: 1ejt (more details), 2 Å

PDB Description: crystal structure of the h219q variant of klebsiella aerogenes urease

SCOP Domain Sequences for d1ejtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejtc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes}
gidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrmlqaadslpv
nigllgkgnvsqpdalreqvaagviglkiqedwgatpaaidcaltvademdiqvalhsdt
lnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnptlpytlnti
dehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssdsqamgrvge
vilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgXmfgalg
sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
evrvdgelitsepadvlpmaqryflf

SCOP Domain Coordinates for d1ejtc2:

Click to download the PDB-style file with coordinates for d1ejtc2.
(The format of our PDB-style files is described here.)

Timeline for d1ejtc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ejtc1