Lineage for d1fwhc2 (1fwh C:130-422,C:476-567)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1571126Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1571190Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 1571191Protein alpha-subunit of urease, catalytic domain [51561] (4 species)
  7. 1571210Species Klebsiella aerogenes [TaxId:28451] [51562] (27 PDB entries)
  8. 1571223Domain d1fwhc2: 1fwh C:130-422,C:476-567 [29036]
    Other proteins in same PDB: d1fwha_, d1fwhb_, d1fwhc1
    complexed with ni

Details for d1fwhc2

PDB Entry: 1fwh (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319y variant
PDB Compounds: (C:) urease

SCOPe Domain Sequences for d1fwhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwhc2 c.1.9.2 (C:130-422,C:476-567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]}
gidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrmlqaadslpv
nigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdiqvalhsdt
lnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnptlpytlnti
dehldmlmvyhhldpdiaedvafaesrirretiaaedvlhdlgafsltssdsqamgrvge
vilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgXmfgalg
sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
evrvdgelitsepadvlpmaqryflf

SCOPe Domain Coordinates for d1fwhc2:

Click to download the PDB-style file with coordinates for d1fwhc2.
(The format of our PDB-style files is described here.)

Timeline for d1fwhc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fwhc1