Lineage for d2ada__ (2ada -)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236978Superfamily c.1.9: Metallo-dependent hydrolases [51556] (12 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 236979Family c.1.9.1: Adenosine deaminase (ADA) [51557] (1 protein)
  6. 236980Protein Adenosine deaminase (ADA) [51558] (2 species)
    Common fold covers the whole protein structure
  7. 236983Species Mouse (Mus musculus) [TaxId:10090] [51559] (8 PDB entries)
  8. 236997Domain d2ada__: 2ada - [29027]
    complexed with hpr, zn

Details for d2ada__

PDB Entry: 2ada (more details), 2.4 Å

PDB Description: atomic structure of adenosine deaminase complexed with a transition-state analog: understanding catalysis and immunodeficiency mutations

SCOP Domain Sequences for d2ada__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ada__ c.1.9.1 (-) Adenosine deaminase (ADA) {Mouse (Mus musculus)}
tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq

SCOP Domain Coordinates for d2ada__:

Click to download the PDB-style file with coordinates for d2ada__.
(The format of our PDB-style files is described here.)

Timeline for d2ada__: