Lineage for d2ada__ (2ada -)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) 
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (8 families) 
Family c.1.9.1: Adenosine deaminase (ADA) [51557] (1 protein) Protein Adenosine deaminase (ADA) [51558] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [51559] (8 PDB entries) 
Domain d2ada__: 2ada - [29027]
Details for d2ada__
PDB Entry: 2ada (more details), 2.4 Å
PDB Description: atomic structure of adenosine deaminase complexed with a transition-state analog: understanding catalysis and immunodeficiency mutations
SCOP Domain Sequences for d2ada__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ada__ c.1.9.1 (-) Adenosine deaminase (ADA) {Mouse (Mus musculus)}
tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
SCOP Domain Coordinates for d2ada__:
Click to download the PDB-style file with coordinates for d2ada__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ada__:
- d2ada__ first appeared (with stable ids) in SCOP 1.55
- d2ada__ appears in SCOP 1.59
- d2ada__ appears in SCOP 1.63
- d2ada__ appears in the current release, SCOPe 2.08, called d2adaa_
View in 3D