Lineage for d1a4lb_ (1a4l B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19134Superfamily c.1.9: Metallo-dependent hydrolases [51556] (3 families) (S)
  5. 19135Family c.1.9.1: Adenosine deaminase (ADA) [51557] (1 protein)
  6. 19136Protein Adenosine deaminase (ADA) [51558] (1 species)
  7. 19137Species Mouse (Mus musculus) [TaxId:10090] [51559] (8 PDB entries)
  8. 19148Domain d1a4lb_: 1a4l B: [29024]

Details for d1a4lb_

PDB Entry: 1a4l (more details), 2.6 Å

PDB Description: ada structure complexed with deoxycoformycin at ph 7.0

SCOP Domain Sequences for d1a4lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4lb_ c.1.9.1 (B:) Adenosine deaminase (ADA) {Mouse (Mus musculus)}
tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq

SCOP Domain Coordinates for d1a4lb_:

Click to download the PDB-style file with coordinates for d1a4lb_.
(The format of our PDB-style files is described here.)

Timeline for d1a4lb_: