Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins) |
Protein Adenosine deaminase (ADA) [51558] (4 species) Common fold covers the whole protein structure |
Species Mouse (Mus musculus) [TaxId:10090] [51559] (10 PDB entries) |
Domain d1a4lb_: 1a4l B: [29024] complexed with dcf, zn |
PDB Entry: 1a4l (more details), 2.6 Å
SCOPe Domain Sequences for d1a4lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4lb_ c.1.9.1 (B:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]} tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
Timeline for d1a4lb_: