SCOP 1.71: Domain d1uip__: 1uip -

Lineage for d1uip__ (1uip -)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.1: Adenosine deaminase (ADA) [51557] (1 protein)

6. Protein Adenosine deaminase (ADA) [51558] (2 species)
   Common fold covers the whole protein structure

7. Species Mouse (Mus musculus) [TaxId:10090] [51559] (8 PDB entries)

8. Domain d1uip__: 1uip - [29022]
   complexed with pur, zn; mutant

Details for d1uip__

PDB Entry: 1uip, 2.4 Å

PDB Description: adenosine deaminase (his 238 glu mutant)

SCOP Domain Sequences for d1uip__:

Sequence; same for both SEQRES and ATOM records:

>d1uip__ c.1.9.1 (-) Adenosine deaminase (ADA) {Mouse (Mus musculus)}
tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervgegyhti
edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq

Timeline for d1uip__:

• d1uip__ first appeared (with stable ids) in SCOP 1.55
  
• d1uip__ appears in SCOP 1.69
  
• d1uip__ is called d1uipa_ in SCOP 1.73
  
• d1uip__ appears in the current release, SCOPe 2.08, called d1uipa_