Lineage for d1uipa_ (1uip A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)
  6. Protein Adenosine deaminase (ADA) [51558] (4 species)
    Common fold covers the whole protein structure
  7. Species Mouse (Mus musculus) [TaxId:10090] [51559] (10 PDB entries)
  8. Domain d1uipa_: 1uip A: [29022]
    complexed with pur, zn; mutant

Details for d1uipa_

PDB Entry: 1uip (more details), 2.4 Å

PDB Description: adenosine deaminase (his 238 glu mutant)
PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d1uipa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uipa_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]}
tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervgegyhti
edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq

SCOPe Domain Coordinates for d1uipa_ are not available.

Timeline for d1uipa_: