SCOPe 2.06: Domain d1uioa_: 1uio A:

Lineage for d1uioa_ (1uio A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)

6. Protein Adenosine deaminase (ADA) [51558] (4 species)
   Common fold covers the whole protein structure

7. Species Mouse (Mus musculus) [TaxId:10090] [51559] (10 PDB entries)

8. Domain d1uioa_: 1uio A: [29021]
   complexed with hpr, zn; mutant

Details for d1uioa_

PDB Entry: 1uio, 2.4 Å

PDB Description: adenosine deaminase (his 238 ala mutant)

PDB Compounds: (A:) adenosine deaminase

SCOPe Domain Sequences for d1uioa_:

Sequence; same for both SEQRES and ATOM records:

>d1uioa_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]}
tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervgagyhti
edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq

Timeline for d1uioa_:

• d1uioa_ first appeared (with stable ids) in SCOP 1.55, called d1uio__
  
• d1uioa_ appears in SCOPe 2.05
  
• d1uioa_ appears in SCOPe 2.07
  
• d1uioa_ appears in the current release, SCOPe 2.08