SCOP 1.75: Domain d1adda_: 1add A:

Lineage for d1adda_ (1add A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.1: Adenosine/AMP deaminase [51557] (2 proteins)

6. Protein Adenosine deaminase (ADA) [51558] (3 species)
   Common fold covers the whole protein structure

7. Species Mouse (Mus musculus) [TaxId:10090] [51559] (8 PDB entries)

8. Domain d1adda_: 1add A: [29020]
   complexed with 1da, zn

Details for d1adda_

PDB Entry: 1add, 2.4 Å

PDB Description: a pre-transition state mimic of an enzyme: x-ray structure of adenosine deaminase with bound 1-deaza-adenosine and zinc-activated water

PDB Compounds: (A:) adenosine deaminase

SCOP Domain Sequences for d1adda_:

Sequence; same for both SEQRES and ATOM records:

>d1adda_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]}
tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq

Timeline for d1adda_:

• d1adda_ first appeared (with stable ids) in SCOP 1.55, called d1add__
  
• d1adda_ appears in SCOP 1.73
  
• d1adda_ appears in SCOPe 2.01
  
• d1adda_ appears in the current release, SCOPe 2.08