![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (13 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.1: Adenosine deaminase (ADA) [51557] (1 protein) |
![]() | Protein Adenosine deaminase (ADA) [51558] (2 species) Common fold covers the whole protein structure |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [51559] (8 PDB entries) |
![]() | Domain d1fkx__: 1fkx - [29018] complexed with prh, zn; mutant |
PDB Entry: 1fkx (more details), 2.4 Å
SCOP Domain Sequences for d1fkx__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fkx__ c.1.9.1 (-) Adenosine deaminase (ADA) {Mouse (Mus musculus)} tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntdaplifkst ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
Timeline for d1fkx__: