Lineage for d1fkx__ (1fkx -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65203Superfamily c.1.9: Metallo-dependent hydrolases [51556] (4 families) (S)
  5. 65204Family c.1.9.1: Adenosine deaminase (ADA) [51557] (1 protein)
  6. 65205Protein Adenosine deaminase (ADA) [51558] (1 species)
  7. 65206Species Mouse (Mus musculus) [TaxId:10090] [51559] (8 PDB entries)
  8. 65211Domain d1fkx__: 1fkx - [29018]

Details for d1fkx__

PDB Entry: 1fkx (more details), 2.4 Å

PDB Description: murine adenosine deaminase (d296a)

SCOP Domain Sequences for d1fkx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkx__ c.1.9.1 (-) Adenosine deaminase (ADA) {Mouse (Mus musculus)}
tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntdaplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq

SCOP Domain Coordinates for d1fkx__:

Click to download the PDB-style file with coordinates for d1fkx__.
(The format of our PDB-style files is described here.)

Timeline for d1fkx__: