![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins) |
![]() | Protein Adenosine deaminase (ADA) [51558] (4 species) Common fold covers the whole protein structure |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [51559] (10 PDB entries) |
![]() | Domain d1fkxa_: 1fkx A: [29018] complexed with prh, zn |
PDB Entry: 1fkx (more details), 2.4 Å
SCOPe Domain Sequences for d1fkxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fkxa_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]} tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntdaplifkst ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
Timeline for d1fkxa_: