SCOPe 2.07: Domain d1a4mb_: 1a4m B:

Lineage for d1a4mb_ (1a4m B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)

6. Protein Adenosine deaminase (ADA) [51558] (4 species)
   Common fold covers the whole protein structure

7. Species Mouse (Mus musculus) [TaxId:10090] [51559] (10 PDB entries)

8. Domain d1a4mb_: 1a4m B: [29015]
   complexed with prh, zn

Details for d1a4mb_

PDB Entry: 1a4m, 1.95 Å

PDB Description: ada structure complexed with purine riboside at ph 7.0

PDB Compounds: (B:) adenosine deaminase

SCOPe Domain Sequences for d1a4mb_:

Sequence; same for both SEQRES and ATOM records:

>d1a4mb_ c.1.9.1 (B:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]}
tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq

Timeline for d1a4mb_:

• d1a4mb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a4mb_ appears in SCOPe 2.06
  
• d1a4mb_ appears in the current release, SCOPe 2.08