Lineage for d1a4mb_ (1a4m B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833367Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)
  6. 2833368Protein Adenosine deaminase (ADA) [51558] (4 species)
    Common fold covers the whole protein structure
  7. 2833391Species Mouse (Mus musculus) [TaxId:10090] [51559] (10 PDB entries)
  8. 2833395Domain d1a4mb_: 1a4m B: [29015]
    complexed with prh, zn

Details for d1a4mb_

PDB Entry: 1a4m (more details), 1.95 Å

PDB Description: ada structure complexed with purine riboside at ph 7.0
PDB Compounds: (B:) adenosine deaminase

SCOPe Domain Sequences for d1a4mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4mb_ c.1.9.1 (B:) Adenosine deaminase (ADA) {Mouse (Mus musculus) [TaxId: 10090]}
tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq

SCOPe Domain Coordinates for d1a4mb_:

Click to download the PDB-style file with coordinates for d1a4mb_.
(The format of our PDB-style files is described here.)

Timeline for d1a4mb_: