Lineage for d1a4ma_ (1a4m A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (5 families) 
Family c.1.9.1: Adenosine deaminase (ADA) [51557] (1 protein) Protein Adenosine deaminase (ADA) [51558] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [51559] (8 PDB entries) 
Domain d1a4ma_: 1a4m A: [29014]
Details for d1a4ma_
PDB Entry: 1a4m (more details), 1.95 Å
PDB Description: ada structure complexed with purine riboside at ph 7.0
SCOP Domain Sequences for d1a4ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4ma_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Mouse (Mus musculus)}
tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervghgyhti
edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq
SCOP Domain Coordinates for d1a4ma_:
Click to download the PDB-style file with coordinates for d1a4ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a4ma_:
- d1a4ma_ first appeared (with stable ids) in SCOP 1.55
- d1a4ma_ appears in SCOP 1.57
- d1a4ma_ appears in SCOP 1.61
- d1a4ma_ appears in the current release, SCOPe 2.08
View in 3D
