Lineage for d1ex1a1 (1ex1 A:1-388)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418583Family c.1.8.7: NagZ-like [51553] (4 protein domains)
    Pfam PF00933; Glycosyl hydrolase family 3 domain
    Some members have reversed beta strand compared to other members of fold
  6. 2418584Protein Beta-D-glucan exohydrolase, N-terminal domain [51554] (2 species)
    interdomain linker forms an additional, N-terminal strand
  7. 2418585Species Barley (Hordeum vulgare) [TaxId:4513] [51555] (9 PDB entries)
  8. 2418593Domain d1ex1a1: 1ex1 A:1-388 [29013]
    Other proteins in same PDB: d1ex1a2
    complexed with fca, glc, man, nag

Details for d1ex1a1

PDB Entry: 1ex1 (more details), 2.2 Å

PDB Description: beta-d-glucan exohydrolase from barley
PDB Compounds: (A:) protein (beta-d-glucan exohydrolase isoenzyme exo1)

SCOPe Domain Sequences for d1ex1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ex1a1 c.1.8.7 (A:1-388) Beta-D-glucan exohydrolase, N-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]}
dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
npyadpamaeqlgkqehrdlareaarks

SCOPe Domain Coordinates for d1ex1a1:

Click to download the PDB-style file with coordinates for d1ex1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ex1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ex1a2